PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pta002178
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Acrogymnospermae; Pinidae; Pinales; Pinaceae; Pinus; Pinus
Family HD-ZIP
Protein Properties Length: 353aa    MW: 39947.1 Da    PI: 4.5263
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PUT-157a-Pinus_taeda-34899PU_refplantGDBView CDS
gnl|UG|Pta#S25096503PU_unrefUnigeneView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox62.18.2e-2067120356
                --SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
   Homeobox   3 kRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                k+++++ eq++ Le+ Fe+++++  e++++LA+ lgL+ rqV vWFqNrRa++k
  Pta002178  67 KKRRLSVEQVRFLEKSFEMDNKLEPERKTQLARDLGLQPRQVAVWFQNRRARWK 120
                556899***********************************************9 PP

2HD-ZIP_I/II134.44e-4367156291
  HD-ZIP_I/II   2 kkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeveeLreel 91 
                  kkrrls eqv++LE+sFe+++kLeperK++lar+LglqprqvavWFqnrRAR+ktkqlE++y+ Lk++yd+l+ + ++L ke+++Lr+e+
    Pta002178  67 KKRRLSVEQVRFLEKSFEMDNKLEPERKTQLARDLGLQPRQVAVWFQNRRARWKTKQLEREYDILKSSYDTLRVDYDNLLKEKDKLRSEV 156
                  9**************************************************************************************987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466898.98E-2058124IPR009057Homeodomain-like
PROSITE profilePS5007117.42762122IPR001356Homeobox domain
SMARTSM003893.4E-1964126IPR001356Homeobox domain
CDDcd000863.09E-1965123No hitNo description
PfamPF000464.8E-1767120IPR001356Homeobox domain
Gene3DG3DSA:1.10.10.606.9E-2069129IPR009057Homeodomain-like
PRINTSPR000311.1E-593102IPR000047Helix-turn-helix motif
PROSITE patternPS00027097120IPR017970Homeobox, conserved site
PRINTSPR000311.1E-5102118IPR000047Helix-turn-helix motif
PfamPF021831.0E-16122163IPR003106Leucine zipper, homeobox-associated
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 353 aa     Download sequence    Send to blast
MASNGIMFNA SNRNLIVMVN EAPSFEANSS LDGVMKNVSK RPFYNTLDAD EAGDEDLLDE  60
CVHQPGKKRR LSVEQVRFLE KSFEMDNKLE PERKTQLARD LGLQPRQVAV WFQNRRARWK  120
TKQLEREYDI LKSSYDTLRV DYDNLLKEKD KLRSEVICLT DKLHAKEKGL EIQTNDLETT  180
CKKAFIQSDS QFESLEKSGI VSEGMTASFD QQLVSYSIED HHSSGTDGSA VVDEESPHHI  240
DSGHSSVVLL GYSTEDPLSS GTDGSDVLDE ESPHHIDSGH SSVVGYITST RVSHIETDQS  300
DFSHVDEERG MSEKLVFPQD CHNLKMECGL FPEAPTTSCN YVFSMDDSWW DWS
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1114122RRARWKTKQ
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Pta.156040.0root| shoot
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
TrEMBLB8LKP40.0B8LKP4_PICSI; Putative uncharacterized protein
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G01470.11e-51homeobox 1